PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0550s0150.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 402aa    MW: 44105.5 Da    PI: 4.6173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0550s0150.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.4e-4871351129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             l+pGfrFhPtd elv++yLk+kv gkkl++ ++i+e++i+k+ PwdLp k ++++++ +wyfF++++kkya+g r +rat+ g+Wk+
  SapurV1A.0550s0150.2.p   7 LTPGFRFHPTDVELVKYYLKRKVLGKKLHF-QAIAEIEINKYAPWDLPdKsCLRTGDLKWYFFCPTEKKYASGVRMKRATDIGFWKT 92 
                             579*************************99.89**************96347788999***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             tgkd++v   k+e+vg+ ktLvf++g+ pkg++tdWvmheyrle
  SapurV1A.0550s0150.2.p  93 TGKDRHVQY-KNEDVGMIKTLVFHTGKPPKGSRTDWVMHEYRLE 135
                             ********9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-545157IPR003441NAC domain
PROSITE profilePS5100551.3217157IPR003441NAC domain
PfamPF023658.6E-269134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MGRNSSLTPG FRFHPTDVEL VKYYLKRKVL GKKLHFQAIA EIEINKYAPW DLPDKSCLRT  60
GDLKWYFFCP TEKKYASGVR MKRATDIGFW KTTGKDRHVQ YKNEDVGMIK TLVFHTGKPP  120
KGSRTDWVMH EYRLEEKELA EKGIAQDGYV LCVLFKKDGP GPKNGAQYGA PFNEDEWDDD  180
EVEEEVNVQL AILPAVMHAH AIMLPTNPNM SIATSSRVSE CTCAGPLISC PSQTPSSACT  240
TLPRVSNDVV ASTESLQVVH GGVNGGEADS SAGMSAPALQ QTCKPNSPIL ASSSSYVPEN  300
TCSAYIPSVS QGEAPQIVDD YDDIFSSLDL LDNVYTESAD FGGIAEAETD KHWSLGGLAP  360
LEDSADSIPI SQYFSQYLPG STADYLELMD LVTPLYQSRE E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-43616316171NAC domain-containing protein 19
4dul_A9e-43616316171NAC domain-containing protein 19
1ut7_B9e-43616316171NO APICAL MERISTEM PROTEIN
1ut7_A9e-43616316171NO APICAL MERISTEM PROTEIN
1ut4_B9e-43616316171NO APICAL MERISTEM PROTEIN
1ut4_A9e-43616316171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022982.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9FY822e-90NAC82_ARATH; NAC domain-containing protein 82
TrEMBLB9HEK00.0B9HEK0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s03840.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-87NAC domain containing protein 103